Spicy Honey Garlic Shrimp
Recipe by Garlicmaster
15 min2 servingseasyshrimpsweet-spicyquick15 minutes
Sweet, spicy and loaded with garlic — these shrimp are ready in 15 minutes and taste like restaurant quality.
- 320
- kcal
- 28 g
- protein
- 22 g
- carbs
- 14 g
- fat
Ingredients
- 300 g raw shrimp
- 5 cloves garlic
- 3 tablespoon honey
- 1 tablespoon Red Dragon Manis
- 2 tablespoon soy sauce
- 30 g butter
- 1 tablespoon lemon juice
- 3 stalks scallions
Method
- 1
Mince the garlic. In a small bowl, whisk together honey, Red Dragon Manis, soy sauce and lemon juice.
- 2
Heat butter in a skillet over high heat. Sear shrimp 1 minute per side until pink.
- 3
Add garlic and cook for 30 seconds. Pour in the sauce mixture.
- 4
Toss everything together for 1-2 minutes over high heat until the sauce reduces into a sticky glaze.
- 5
Top with sliced scallions and serve with rice or bread.
Tip from Garlicmaster: Always use raw shrimp, never pre-cooked ones — they turn rubbery. And make sure the sauce really reduces down — that glaze is everything.
