Flame Fusion XL Chicken Nuggets Dip
Recipe by Garlicmaster
20 min3 servingseasychickenkid-friendlyquickdip
Crispy chicken nuggets with a creamy spicy dip — quick classic for the whole family.
- 460
- kcal
- 22 g
- protein
- 26 g
- carbs
- 30 g
- fat
Ingredients
- 500 g chicken nuggets
- 5 tablespoon Flame Fusion Mayonaise XL
Method
- 1
Bake or deep fry the chicken nuggets according to package instructions until golden brown and crispy.
- 2
Scoop the Flame Fusion Mayonaise XL into one or more small dipping bowls.
- 3
Let the nuggets drain briefly on paper towels.
- 4
Serve the hot nuggets with the dip on the side.
- 5
Optionally add some fresh vegetables or a simple salad on the side.
Tip from Garlicmaster: For children who don't like spicy food: mix the dip half and half with regular mayonnaise for a milder version.
